PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 187aa    MW: 21741.4 Da    PI: 6.7885
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27530.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.3e-14243748
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
       KHN27530.1  2 EEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 43
                     9***************************************97 PP

2Myb_DNA-binding55.99.9e-184992146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
       KHN27530.1 49 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 92
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.779143IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-19250IPR009057Homeodomain-like
CDDcd001671.68E-8243No hitNo description
SMARTSM007174.1E-5245IPR001005SANT/Myb domain
PfamPF002491.6E-12243IPR001005SANT/Myb domain
SuperFamilySSF466892.7E-26290IPR009057Homeodomain-like
PROSITE profilePS5129425.8594498IPR017930Myb domain
SMARTSM007171.8E-154896IPR001005SANT/Myb domain
PfamPF002491.4E-164992IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-255198IPR009057Homeodomain-like
CDDcd001671.75E-125392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MEEDLILINY IANHGEGVWN SLAKAAGLKR TGKSCRLRWL NYLRPDVRRG NITPEEQLLI  60
MELHAKWGNR WSKIAKHLPG RTDNEIKNYW RTRIQKHIKQ AENFQQQISN NSEINDHQAS  120
TSHVSTMAEP METYSPPFYQ GMLEPFSSIQ FPTINPDQSS CCTNDNNNSI NYWSMEDIWS  180
MQLLNGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2129813108B-MYB
1h8a_C4e-2129833128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0901840.0BT090184.1 Soybean clone JCVI-FLGm-3H24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235850.11e-140MYB transcription factor MYB181
SwissprotP813912e-82MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A0B2R1C31e-140A0A0B2R1C3_GLYSO; Myb-related protein 305
STRINGGLYMA16G07960.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-83myb domain protein 21
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]